DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35g1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_780716.1 Gene:Slc35g1 / 240660 MGIID:2444789 Length:368 Species:Mus musculus


Alignment Length:288 Identity:48/288 - (16%)
Similarity:91/288 - (31%) Gaps:83/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGL 157
            :.|..:..::|.||::.....|......:|..:..:|..||:.:||....:  .|.|.||:..  
Mouse   136 LFLRGVFGSSAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIFLKEKYS--LWDAFFTLFA-- 196

  Fly   158 LDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQ 222
                                      :.|.:||:....:.|..         ||.:....:...:
Mouse   197 --------------------------IAGVILIVRPPFIFGSD---------TSGMRESYSEHIK 226

  Fly   223 GIF-GLGITSMLAICMNFL----PSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTIS-C 281
            |.| .:|...:.||.:..|    .|:|.|       ...|..:...|..:|.::..:..:::. |
Mouse   227 GTFAAIGHAVLAAITLVILRKMGKSVDYF-------LSIWYYVILGLPEAIIILFVIGEWSLPYC 284

  Fly   282 AMYNFIGLYIAMYSSSANRLLADGLRVYFIWVFVIIMEWEYMNLVTIMGFLILQMGIILYRQALF 346
            .:.....:.|.:........:...:::            |...||.||..:.:....|.  |..|
Mouse   285 GLDRLFLILIGLLGLGGQIFITKAVQI------------EKAGLVAIMKTMDIVFAFIF--QIAF 335

  Fly   347 LD----WYR-------------AAVARW 357
            .|    |:.             |.:.||
Mouse   336 FDNVPTWWTVGGALCVVVSTTGATIRRW 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35g1NP_780716.1 EamA 72..205 CDD:279264 18/98 (18%)
RhaT 73..362 CDD:223769 46/285 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.