DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35a1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006537954.1 Gene:Slc35a1 / 24060 MGIID:1345622 Length:376 Species:Mus musculus


Alignment Length:292 Identity:56/292 - (19%)
Similarity:107/292 - (36%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LMFLGEFLCFA-VFKV---IRLISNRRGVISDLDSILSQD--SSEFRPVSMLLPTLLDAAASILL 107
            |.|....:|.. |.|:   :.|::...|.:....:.||::  .|......:.:|:|:.|..:.:.
Mouse    41 LYFSTTAVCITEVIKLLISVGLLAKETGSLGRFKASLSENVLGSPKELAKLSVPSLVYAVQNNMA 105

  Fly   108 FTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDL 172
            |..|....|..:|:.....:....:.:.:.||.||:...|:::|.: ||.:.::.....:....:
Mouse   106 FLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWISVFML-CGGVTLVQWKPAQATKVV 169

  Fly   173 VTLP---YTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQG-IFGLGITSML 233
            .|:|   .|...|.::|          |.|..:.::|......|:.|.....|. :.|.|..::.
Mouse   170 PTVPGSMPTVSDSDVSG----------HVLMRIGKQKAALYGKVSALTGKVAQNPLLGFGAIAIA 224

  Fly   234 AICMNFLPSIDPFSCSSRAVFDDWGDLFAAL--QGSISLIMTLIAFTISCAMYNFIGLYIAMYSS 296
            .:|..|.                 |..|..:  ....||.:..|...:|..:....|.|      
Mouse   225 VLCSGFA-----------------GVYFEKVLKSSDTSLWVRNIQMYLSGIVVTLAGTY------ 266

  Fly   297 SANRLLADGLRV----------YFIWVFVIIM 318
                 |:||..:          |::| |||.:
Mouse   267 -----LSDGAEIQEKGFFYGYTYYVW-FVIFL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35a1XP_006537954.1 Nuc_sug_transp 8..354 CDD:282054 56/292 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.