DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35a2

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_511039.2 Gene:Slc35a2 / 22232 MGIID:1345297 Length:393 Species:Mus musculus


Alignment Length:290 Identity:56/290 - (19%)
Similarity:110/290 - (37%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VIRLISNRRGVISDL-----DSILSQ--DSSEFRPVSMLLPTLLDAAASILLFTGLYLTYATSFQ 120
            ::.|.:.:||.:..|     :::|.|  |:     :.:.:|:|:....:.|.:..:....|.:||
Mouse    83 LLLLFAQKRGNVKHLVLFLHEAVLVQYVDT-----LKLAVPSLIYTLQNNLQYVAISNLPAATFQ 142

  Fly   121 MIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIIS----------LDVHRVEYDLVTL 175
            :.....::...:||.:.||.:|:...|.::..:..|:..:.:          ||.:.        
Mouse   143 VTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLDQNP-------- 199

  Fly   176 PYTDYKSILTGDLLIIIAEIL-HGLQYVCEEKQLKTSNVAPLQAAGW-----QGIFG--LGITSM 232
                     ...|..::|..| .|...|..||.||.|:     .:.|     .|:||  ||:..:
Mouse   200 ---------GAGLAAVVASCLSSGFAGVYFEKILKGSS-----GSVWLRNLQLGLFGTALGLVGL 250

  Fly   233 -----LAIC-----MNFLPSI------DPFSCSSRAVFDDWGD-LFAALQGSISLIMTLIAFTIS 280
                 .|:.     ..:.|::      ..|.....||...:.| :......|:|::::.:|   |
Mouse   251 WWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVA---S 312

  Fly   281 CAMYNF---------IGLYI-AMYSSSANR 300
            ..::.|         .||.| |:|..|..|
Mouse   313 IRLFGFHLDPLFALGAGLVIGAVYLYSLPR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35a2NP_511039.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Nuc_sug_transp 31..339 CDD:282054 54/285 (19%)
nst 114..338 CDD:129885 47/248 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.