DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35f1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_848790.2 Gene:Slc35f1 / 215085 MGIID:2139810 Length:408 Species:Mus musculus


Alignment Length:355 Identity:79/355 - (22%)
Similarity:143/355 - (40%) Gaps:71/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLGEFLCFAVFKVIRLISNRRGVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTY 115
            ||...|.|.|:..  .::.|:|. .:|.:||.:     |....::..|:|..|:.|:......|.
Mouse    98 FLNYILLFLVYTT--TLAVRQGE-ENLLAILRR-----RWWKYMILGLIDLEANYLVVKAYQYTT 154

  Fly   116 ATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVTLPYTDY 180
            .||.|::....:..|.:.|..||.......|::.|.....|:..::..||      ||.......
Mouse   155 LTSVQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADV------LVGRHQGAG 213

  Fly   181 KSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICMNFLPSID- 244
            ::.|.||||::....|:|:..|.||..::|  ::.::..|..|:||...:.:....|.....:. 
Mouse   214 ENKLVGDLLVLGGATLYGISNVWEESIIRT--LSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKV 276

  Fly   245 PFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISC--AMYNFIGLYIAMYSSSA---NRLLAD 304
            |:         ||         .|.|:  .:.|: :|  .:|:|:.:.|...|:::   :.|.||
Mouse   277 PW---------DW---------QIGLL--YVGFS-ACMFGLYSFMPVVIKKTSATSVNLSLLTAD 320

  Fly   305 GLRVYFIWVFVIIMEWEYMNLVTIMGFLILQMGIILYRQALFLDWYRAAVARWYR---------- 359
               :|.::..:.:..:::..|..:..|.|| :|::||...   ..|.|...|.|:          
Mouse   321 ---LYSLFCGLFLFHYKFSGLYLLSFFTIL-IGLVLYSST---STYIAQDPRVYKQFRNPSGPVV 378

  Fly   360 -----------ARYVDLGTENAAAPNSRPA 378
                       ..|..||.|....|:.|.|
Mouse   379 DLPSTAQVEPSVTYTSLGQETEEEPHVRVA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35f1NP_848790.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SLC35F 56..355 CDD:283644 68/297 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.