DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and nstp-3

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_504521.2 Gene:nstp-3 / 191128 WormBaseID:WBGene00022577 Length:344 Species:Caenorhabditis elegans


Alignment Length:292 Identity:58/292 - (19%)
Similarity:112/292 - (38%) Gaps:74/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VVFTLL-MFLGEFLCFAVFKVIRLISNRRGV--ISDLDSILSQDSSEFRPVSMLLPTLLDAAASI 105
            |.||.: :|:.|.:...|...|.:.:.:..:  |::|...:.:..||  .:.:.:|.|:....:.
 Worm    40 VFFTTVNVFMMEIIKVVVCSAIMIYTTKSVMKYINELKLAIFEHRSE--TLKVCIPALIYTLQNN 102

  Fly   106 LLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEY 170
            |.:..|....||:|.:.....:....||...||...|:.:.|.|:..:..|:.||        :|
 Worm   103 LYYIALSHLEATTFCISYQMKIFTTAIFMYFFLGKKLSTKQWWALVLLVLGVADI--------QY 159

  Fly   171 ---------DLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVA------------ 214
                     |:...|...:.::||.......|.:     |:  ||.||:||.:            
 Worm   160 VYSPPPASEDVEQNPMYGFMAVLTMCFTSAFAGV-----YL--EKVLKSSNASIWVQNIRLALIG 217

  Fly   215 -PL---------------QAA--GWQ-GIFGLGITS-----MLAICMNFLPSIDPFSCSSRAVFD 255
             |:               |.|  ||. .:..|.:|:     ::::.:.:..:|......|.|:..
 Worm   218 LPISFLSMWYYDWEKINEQGAFRGWDFVVVCLTVTNSVGGILISVVIKYADNILKAYAQSMAIIG 282

  Fly   256 ---------DWGDLFAALQGSISLIMTLIAFT 278
                     |:...|..|.|:..:|:::|.:|
 Worm   283 AAVGSWILFDFAPGFMFLLGTFMVIVSIIIYT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
nstp-3NP_504521.2 Nuc_sug_transp 6..314 CDD:282054 57/290 (20%)
EamA 89..313 CDD:304911 46/238 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.