DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and nstp-7

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_503252.3 Gene:nstp-7 / 187072 WormBaseID:WBGene00019451 Length:356 Species:Caenorhabditis elegans


Alignment Length:348 Identity:75/348 - (21%)
Similarity:137/348 - (39%) Gaps:66/348 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLIFVLS-GTFNVLVVKWANQQQVIGSDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLISNR 70
            ||:|.|.: .|....:||.||:...:.              |..:|:.|.|..:...:|.||..|
 Worm    36 LSMIAVTTHHTAMPFLVKIANKSHFLP--------------TTSVFMMEILKLSFCLIIVLIETR 86

  Fly    71 --RGVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIF 133
              |.....|...:.|:..|...||  :|.|:.|..:.|.:..|....||::.:.....::...|.
 Worm    87 SIRKTAKKLHKNIWQNWWETMKVS--VPALVYAVQNNLYYVALANIDATTYSVTLQLRILTTAIL 149

  Fly   134 STMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHG 198
            |.:.|:..|:|..|:|   ....|:.:|          :|.|..::.:..:.|:..:.:|.:| |
 Worm   150 SVVLLSKKLSGYQWMA---QGMALIGVI----------VVQLDNSNSRREIAGNFWLGLASVL-G 200

  Fly   199 LQY------VCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICMNFLPSIDPFSCSSRAVFDDW 257
            :.:      |..||.||.|:     |..|.....|.|.::|...:..| |.|..:..:..:|..|
 Worm   201 MCWTSAFAGVYFEKMLKNSS-----ADVWIQNIRLSILTLLFAGITML-SKDGDAIITGNIFHGW 259

  Fly   258 GDLFAALQGSISLIMTLIAFTISCAMYNFI-GLYIAM---YSSSANRLLADGLRVYFIWVFVIIM 318
                           |.|.:.::..  |.| ||.|::   |:.:..:.....|.:.|..:..|.:
 Worm   260 ---------------TWIVWLVTIG--NSIGGLCISLVMKYADNVMKTYCQSLAIGFTSIVSICL 307

  Fly   319 EWEYMNLVTIMGFLILQMGIILY 341
            ....::|....|..::...:::|
 Worm   308 GDRLLSLYLGYGVFLVTSSVVVY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
nstp-7NP_503252.3 RhaT 35..332 CDD:223769 75/348 (22%)
EamA 108..330 CDD:304911 53/260 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.