DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and ugtp-1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_498930.1 Gene:ugtp-1 / 176227 WormBaseID:WBGene00022721 Length:355 Species:Caenorhabditis elegans


Alignment Length:253 Identity:46/253 - (18%)
Similarity:97/253 - (38%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGL 157
            |.:|:...|..:.|.|.||....|..:|:.....::....|..:||....:.|.|:||..:..| 
 Worm   123 MSVPSFAYALQNNLDFVGLSNLDAGLYQVTTQLKVVSTAFFMMLFLGRKFSTRRWMAITLLMFG- 186

  Fly   158 LDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQ 222
              :..:.::.|............::.:.|...::...:..|...|..||.||.....|......|
 Worm   187 --VAFVQMNNVSASEANTKRETAENYIVGLSAVLATCVTAGFAGVYFEKMLKDGGSTPFWIRNMQ 249

  Fly   223 GIFGLGITSMLAICMNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNFI 287
             ::..|:.|....|:.....|     |.:..|..:.|       .:..::.|:...         
 Worm   250 -MYSCGVISASIACLTDFSRI-----SDKGFFFGYTD-------KVWAVVILLGVG--------- 292

  Fly   288 GLYIAM---YSSSANRLLADGLRVYFIWVF-VIIMEWEYMNLVTIMGFLILQMGIILY 341
            ||||::   |..:..:.:|..:.:..:.|. ::|....::.:..::|.:.:.:.::||
 Worm   293 GLYISLVMRYLDNLYKSMASAVSIILVVVLSMLIFPDIFIGMYFVLGTICVVLAVLLY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
ugtp-1NP_498930.1 Nuc_sug_transp 37..351 CDD:282054 46/253 (18%)
nst 122..350 CDD:129885 44/251 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.