DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and C29H12.2

DIOPT Version :10

Sequence 1:NP_650136.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001379741.1 Gene:C29H12.2 / 174022 WormBaseID:WBGene00016235 Length:393 Species:Caenorhabditis elegans


Alignment Length:40 Identity:12/40 - (30%)
Similarity:20/40 - (50%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 DELLTVNRKEQV--HLNG--------MFSHEDTIARLTAK 248
            ||.:...:.|:|  :|||        |.|.:.|:.:|.:|
 Worm    85 DEDILKRKAEEVKPYLNGRSMYLVGMMGSGKTTVGKLMSK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_650136.1 None
C29H12.2NP_001379741.1 RhaT <107..341 CDD:440461 5/18 (28%)

Return to query results.
Submit another query.