DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35b1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_058032.3 Gene:Slc35b1 / 110172 MGIID:1343133 Length:322 Species:Mus musculus


Alignment Length:340 Identity:60/340 - (17%)
Similarity:123/340 - (36%) Gaps:106/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LMFLGEFLCFAVFKVI--RLISNRRGVISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLF--- 108
            |.|||.|:|:..:.::  ::...:.|      ....|::..|....:.:..:::|..:.:|.   
Mouse    16 LCFLGVFVCYFYYGILQEKITRGKYG------EGPKQETFTFALTLVFIQCVINAMFAKILIQFF 74

  Fly   109 ---------TGLYLTYATSF---QMIRGAALIFVGI-----------FSTMFLNHTLTGR----- 145
                     |.||...:.|:   .:...:||.||..           ...|.|..||..:     
Mouse    75 DTARVDRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLA 139

  Fly   146 HWLAIFTISCGLL-------DIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVC 203
            .:|.:..|..|:.       .::.::.|.|.:               |:||::::..|.||..|.
Mouse   140 KYLCVLLIVAGVALFMYKPKKVVGIEEHTVGF---------------GELLLLMSLTLDGLTGVS 189

  Fly   204 EE---KQLKT-SNVAPLQAAGWQG-IFGLGITSMLAICMNFLPSIDPFSCSSRAVFDDWGDLFAA 263
            ::   ...:| ||...|....|.. :.|.||                       :|.  |:|:..
Mouse   190 QDHMRAHYQTGSNHMMLNINLWSTFLLGAGI-----------------------LFT--GELWEF 229

  Fly   264 L---QGSISLIMTLIAFTISCAM-YNFIGLYIAMYSSSANRLLADGLRVYFIWVFVII------- 317
            |   :...::|..::.|.::.|: .:||.:.:..:......::....:.:.|...||:       
Mouse   230 LSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISS 294

  Fly   318 MEWEYMNLVTIMGFL 332
            |:|    :.|::.||
Mouse   295 MQW----VGTVLVFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35b1NP_058032.3 UAA 16..309 CDD:312076 60/340 (18%)
Di-lysine motif 318..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.