DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and Slc35b3

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_006516590.1 Gene:Slc35b3 / 108652 MGIID:1913978 Length:444 Species:Mus musculus


Alignment Length:341 Identity:71/341 - (20%)
Similarity:126/341 - (36%) Gaps:103/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LHGFQHPVVFTLLMF--------LGEFLCFAVFKVIRL---ISNRRGVISDLDSILSQDSSEFRP 90
            ::|:...::|::..|        |.:|..::||.:|.|   ...||..:|...|..|  ..|:|.
Mouse   106 IYGYLQELIFSVEGFKPYGWYLTLVQFAFYSVFGLIELQLTQDRRRSPVSPSVSFFS--VYEYRW 168

  Fly    91 VSM--------LLPTLLDAAASILLF----------TGL-YLTYATS--FQMIRGAALIFVGIFS 134
            .|:        .:|.:......::.|          |.| ||.|.|.  |:..:...::..|:| 
Mouse   169 SSLSGTPWFITFIPRIPGKTYMLIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVF- 232

  Fly   135 TMFLNHTLTGRHW-LA-IFTISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILH 197
                   :.|:.: || :....|..|.:|...:    .|....|..:    |||.:||.:|....
Mouse   233 -------IQGKRYNLADVSAAVCMSLGLIWFTL----ADSTIAPNFN----LTGVMLISLALCAD 282

  Fly   198 GLQYVCEEKQLKTSNVAPLQ------AAGWQGI-FGLGITSMLAICMNFLPSIDPFSCSSRAVFD 255
            .:....:||.:|..|.:..:      :.|:..| .||..||.|...:.|        ||...| .
Mouse   283 AVIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLSCTSGLGPAVAF--------CSKNPV-G 338

  Fly   256 DWGDLFA-ALQG--SISLIMTLI----------------AFTISCAMYNF--------------- 286
            .:|..|. :|.|  .||.::.||                |.|:..:...|               
Mouse   339 TYGYAFLFSLTGYFGISFVLALIKIFGALLAVTVTTGRKAMTVVLSFLFFAKPFTFQYIWSGLLV 403

  Fly   287 -IGLYIAMYSSSANRL 301
             :|:::.:||.:.:::
Mouse   404 VLGIFLNVYSKNMDKI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
Slc35b3XP_006516590.1 UAA 92..414 CDD:312076 70/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.