DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and SLC35A1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_006407.1 Gene:SLC35A1 / 10559 HGNCID:11021 Length:337 Species:Homo sapiens


Alignment Length:184 Identity:42/184 - (22%)
Similarity:75/184 - (40%) Gaps:37/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LMFLGEFLCFAVFKVIRLISNRRGVISDLDSILSQDSSEFR------PVSML---LPTLLDAAAS 104
            |.|....:|  :.:||:|:.: .|:::.....|.:..:..|      |..:|   :|:|:.|..:
Human    41 LYFSTTAVC--ITEVIKLLLS-VGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQN 102

  Fly   105 ILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAIFTISCGLLDIISLDVHRVE 169
            .:.|..|....|..:|:.....:....:.:.:.||.||:...|:::|.:..|             
Human   103 NMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAG------------- 154

  Fly   170 YDLVTL----PYTDYKSI-----LTGDLLIIIAEILHGLQYVCEEKQLKTSNVA 214
               |||    |....|.:     |.|...|.||.:..|...|..||.||:|:.:
Human   155 ---VTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTS 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
SLC35A1NP_006407.1 Nuc_sug_transp 8..314 CDD:282054 42/184 (23%)