DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and slc35g1

DIOPT Version :9

Sequence 1:NP_001303462.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_001341822.1 Gene:slc35g1 / 100001920 ZFINID:ZDB-GENE-121214-166 Length:409 Species:Danio rerio


Alignment Length:219 Identity:47/219 - (21%)
Similarity:84/219 - (38%) Gaps:59/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAI 235
            ||..:|||      ..|:.::..::..|  .|.||.:::|.:..|...||.......|  :...:
Zfish    17 DLSVVPYT------ADDIRVLCHKVEDG--KVGEEFEMRTLSEVPDGDAGESRPVNRG--AFYRV 71

  Fly   236 CMNFLPSIDPFSCSSRAVFDDWGD------------------------LFAALQGSISLIMT--- 273
            |   ||:....|.:.|...:|.|:                        |.|::..||:.::.   
Zfish    72 C---LPACCKRSDTHRDEDEDDGEEDTGENTVQKEKQPSCPGLGLMYSLLASVFFSIAALLVKKM 133

  Fly   274 --LIAFTISCAMYNFIGLYI--AMYSSSANRLLADGLRVY-FIWVFVIIMEWEYMNLVTIMGFLI 333
              :.|..||.....|..|::  ||.......|...|:|:| |:..|:      ..|.:.::.:.:
Zfish   134 EGMHAIQISAIRCFFQMLFVLPAMIYYKTGFLGPRGMRIYLFLRGFL------GSNAMILLYYAV 192

  Fly   334 LQM-----GIILYRQALF---LDW 349
            |||     .:|::...:|   |.|
Zfish   193 LQMPLADATVIMFSNPVFTALLAW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_001303462.1 None
slc35g1XP_001341822.1 EamA 110..243 CDD:279264 25/113 (22%)
RhaT 111..400 CDD:223769 25/112 (22%)
EamA 263..398 CDD:279264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.