Sequence 1: | NP_001303462.1 | Gene: | Tango9 / 41450 | FlyBaseID: | FBgn0260744 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001341822.1 | Gene: | slc35g1 / 100001920 | ZFINID: | ZDB-GENE-121214-166 | Length: | 409 | Species: | Danio rerio |
Alignment Length: | 219 | Identity: | 47/219 - (21%) |
---|---|---|---|
Similarity: | 84/219 - (38%) | Gaps: | 59/219 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 DLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAI 235
Fly 236 CMNFLPSIDPFSCSSRAVFDDWGD------------------------LFAALQGSISLIMT--- 273
Fly 274 --LIAFTISCAMYNFIGLYI--AMYSSSANRLLADGLRVY-FIWVFVIIMEWEYMNLVTIMGFLI 333
Fly 334 LQM-----GIILYRQALF---LDW 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tango9 | NP_001303462.1 | None | |||
slc35g1 | XP_001341822.1 | EamA | 110..243 | CDD:279264 | 25/113 (22%) |
RhaT | 111..400 | CDD:223769 | 25/112 (22%) | ||
EamA | 263..398 | CDD:279264 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |