DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and GGC1

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_010083.1 Gene:GGC1 / 851329 SGDID:S000002357 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:82/309 - (26%)
Similarity:133/309 - (43%) Gaps:65/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KIINGGVAGIIGVACVYPLDMVKTRLQNQ----TIG--------------PNGERMYTSIADCFR 69
            :::....|||:.:|..:|:|.:..||.:.    |.|              |.|:|::|       
Yeast    13 RLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFT------- 70

  Fly    70 KTIASEGYFGMYRGSAVNIVLITPEKAIKL----TANDFFRYHLASD-DGVI-----PLSRATLA 124
             .....||...|:      ||   ::..|.    .||:|...|...| |.:.     ...|:..|
Yeast    71 -LFPGLGYAASYK------VL---QRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAA 125

  Fly   125 GGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVG 189
            |.|.|:.:||: .|:::|||:.|     ...:...||        |..| :||:.|:|.||:|.|
Yeast   126 GSLIGIGEIVL-LPLDVLKIKRQ-----TNPESFKGR--------GFIK-ILRDEGLFNLYRGWG 175

  Fly   190 ATGVRDITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ 254
            .|..|:...|...|...|:..:......|.| :|.:..:.|:.::...:|..:..|.||:|||:|
Yeast   176 WTAARNAPGSFALFGGNAFAKEYILGLKDYS-QATWSQNFISSIVGACSSLIVSAPLDVIKTRIQ 239

  Fly   255 ADGEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAP----LFGIAQ 299
            .......:..:..|..|||.||::|||||...:::...|    .|.:||
Yeast   240 NRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 78/293 (27%)
Mito_carr 16..106 CDD:278578 23/104 (22%)
Mito_carr 123..203 CDD:278578 26/79 (33%)
Mito_carr 228..302 CDD:278578 24/76 (32%)
GGC1NP_010083.1 Mito_carr 115..201 CDD:395101 29/100 (29%)
Mito_carr 206..286 CDD:395101 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0750
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.