DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and AT1G74240

DIOPT Version :10

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_177564.2 Gene:AT1G74240 / 843764 AraportID:AT1G74240 Length:364 Species:Arabidopsis thaliana


Alignment Length:72 Identity:14/72 - (19%)
Similarity:29/72 - (40%) Gaps:24/72 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LISQGSAVLENLKSQHLNLRGVGRKMHEIGQALGLSNSTLQVIDRRVREDWILFVIGCIVCCIFM 204
            ::|..:.::::.|:.:|.|...  |...:.|.||.:                   :|||:..:  
plant   452 IVSTAADLMQDFKTGYLTLSSA--KSMFVTQLLGTA-------------------MGCIIAPL-- 493

  Fly   205 YAFYRFW 211
             .|:.||
plant   494 -TFWLFW 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 Mito_carr 16..106 CDD:395101
Mito_carr 123..203 CDD:395101 11/62 (18%)
Mito_carr 228..302 CDD:395101
AT1G74240NP_177564.2 PTZ00168 34..332 CDD:185494
Mito_carr 265..339 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.