DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and slc25a47a

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001038779.1 Gene:slc25a47a / 724009 ZFINID:ZDB-GENE-060616-266 Length:294 Species:Danio rerio


Alignment Length:283 Identity:78/283 - (27%)
Similarity:137/283 - (48%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSA 85
            |...:.|...|..|||..||||.||.|:|.|       :.:|.|..|...||..||..|.::|  
Zfish     3 FADFLAGSFGGACGVAVGYPLDTVKVRIQTQ-------KQFTGIWQCIVLTIRKEGVHGFFKG-- 58

  Fly    86 VNIVLITPEKAIKLTANDFF----------RYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPME 140
                :..|...|.:|::..|          .|...:::..:.:..:.||||:|   |:.|.:|.:
Zfish    59 ----MFLPITTISMTSSVVFGTYRNCLQALSYIRKAENTKLDVFMSGLAGGVA---QVSVMSPGD 116

  Fly   141 LLKI--QMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRD----ITFS 199
            ::|:  |.|...|.:...:.:.:. |....:....::.||:|:.|||:|.....:||    .|:.
Zfish   117 IVKVRLQCQTESRHSVNPKYSVKP-KYSGPIHCLLSICREQGLSGLYRGALPLALRDGPSFATYF 180

  Fly   200 MVYFPLMAWINDQGPRKSDGSGEAVFYWS--LIAGLLSGMTSAFMVTPFDVVKTRLQAD---GEK 259
            :.|..|.|.:...|.::.:        |:  |::|.::||:...:.||.||:|.|||.|   |::
Zfish   181 LTYHTLCARLTPDGQKEPE--------WTVVLLSGGVAGMSGWAVGTPMDVIKARLQMDGVRGQR 237

  Fly   260 KFKGIMDCVNRTLKEEGISAFFK 282
            :::|::.|:..|.:.||:..||:
Zfish   238 RYRGLLHCLTVTTRTEGLGVFFR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 78/283 (28%)
Mito_carr 16..106 CDD:278578 28/94 (30%)
Mito_carr 123..203 CDD:278578 23/85 (27%)
Mito_carr 228..302 CDD:278578 21/60 (35%)
slc25a47aNP_001038779.1 Mito_carr 3..77 CDD:278578 28/86 (33%)
Solcar 1 4..83 27/91 (30%)
Solcar 2 95..189 25/97 (26%)
Mito_carr 98..183 CDD:278578 23/88 (26%)
Mito_carr 196..288 CDD:278578 22/73 (30%)
Solcar 3 198..286 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.