DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Slc25a18

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001074517.1 Gene:Slc25a18 / 71803 MGIID:1919053 Length:320 Species:Mus musculus


Alignment Length:314 Identity:150/314 - (47%)
Similarity:202/314 - (64%) Gaps:24/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QKFNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGM 80
            |..::..|:||||:||::||.||:|:|:.|||||||    .|:.:|..:.||..||..:||:.||
Mouse     9 QDLSISAKLINGGIAGLVGVTCVFPIDLAKTRLQNQ----QGKDVYRGMTDCLMKTARAEGFLGM 69

  Fly    81 YRGSAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQ 145
            |||:|||:.|:||||||||.||||.|..|..|.....|....|||..||:.|:|:|.|||:||||
Mouse    70 YRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQ 134

  Fly   146 MQDAGRVAAADRAAGREVKTIT--ALGLTKT------------LLRERGIFGLYKGVGATGVRDI 196
            :|||||:|...:|:.....|..  :.|.|.|            |||.:|:.|||:|:|||.:|||
Mouse   135 LQDAGRLAVCHQASASATPTSRPYSTGSTSTHRRPSATLIARELLRTQGLSGLYRGLGATLLRDI 199

  Fly   197 TFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ----ADG 257
            .||::||||.|.:|..|  .|:.:|:|.|..|.:||..:|..:|..|||.||:|||:|    ..|
Mouse   200 PFSIIYFPLFANLNQLG--VSELTGKASFTHSFVAGCTAGSVAAVAVTPLDVLKTRIQTLKKGLG 262

  Fly   258 EKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEKIL 311
            |..:.|:.||..:...:||.:||.||..||.:|:||||||||..||:|:||:||
Mouse   263 EDTYSGVTDCARKLWTQEGPAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERIL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 134/290 (46%)
Mito_carr 16..106 CDD:278578 50/89 (56%)
Mito_carr 123..203 CDD:278578 42/93 (45%)
Mito_carr 228..302 CDD:278578 36/77 (47%)
Slc25a18NP_001074517.1 Mito_carr 11..99 CDD:365909 50/91 (55%)
Solcar 1 11..97 50/89 (56%)
Solcar 2 105..215 49/109 (45%)
Mito_carr 111..209 CDD:365909 45/97 (46%)
Solcar 3 224..313 41/88 (47%)
Mito_carr 225..307 CDD:365909 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4855
eggNOG 1 0.900 - - E1_KOG0750
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2232
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53612
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8687
orthoMCL 1 0.900 - - OOG6_104895
Panther 1 1.100 - - O PTHR45678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X982
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.