DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG1907

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:296 Identity:84/296 - (28%)
Similarity:140/296 - (47%) Gaps:35/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKKPQK---FNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIA 73
            |:.|:|   .|.. |.:.||::|:.....|.|||:||||:|....| :|::.|.|...|.:..::
  Fly     7 QEAPKKAVATNAI-KFLFGGLSGMGATMVVQPLDLVKTRMQISGAG-SGKKEYRSSLHCIQTIVS 69

  Fly    74 SEGYFGMYRGSAVNIV----LITPEKAIKLTANDFFRYHLASDDGVI-PLSRATLAGGLAGLFQI 133
            .||...:|:|....::    ..|....:....||.||.......|:. .::..|:||. .|.|  
  Fly    70 KEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGA-CGAF-- 131

  Fly   134 VVTTPMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKG----VGATGVR 194
             :.||.|:..::|...||:..|:|.....|....|     .:.||.|:..|::|    ||...|.
  Fly   132 -IGTPAEVALVRMTSDGRLPVAERRNYTNVANALA-----RITREEGLTALWRGSLPTVGRAMVV 190

  Fly   195 DITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ----A 255
            ::|....|.....:.. .||.:.:...:..|..|:::|||:.:||    .|.|:.|||:|    .
  Fly   191 NMTQLASYSQFKTYFR-HGPLQMEEGIKLHFCASMLSGLLTTITS----MPLDIAKTRIQNMKMV 250

  Fly   256 DGEKKFKGIMDCVNRTLKEEGISAFFKG---GLCRI 288
            ||:.:::|..|.:.|..::||:.|.:||   ..||:
  Fly   251 DGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 83/294 (28%)
Mito_carr 16..106 CDD:278578 27/96 (28%)
Mito_carr 123..203 CDD:278578 23/83 (28%)
Mito_carr 228..302 CDD:278578 24/68 (35%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 28/94 (30%)
Mito_carr 118..207 CDD:278578 25/98 (26%)
Mito_carr 219..307 CDD:278578 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.