DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and mfrn

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:288 Identity:62/288 - (21%)
Similarity:119/288 - (41%) Gaps:31/288 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNIVLI 91
            |.:||::....:||||.||||:  |::.|..:.|  :|....|..|..||.....||::..::..
  Fly    21 GAIAGVLEHVVMYPLDSVKTRM--QSLSPPTKNM--NIVSTLRTMITREGLLRPIRGASAVVLGA 81

  Fly    92 TPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAAD 156
            .|..::...|.:..:...|....|..|: ..::|.:|.|....:::|.:::|.:||....     
  Fly    82 GPAHSLYFAAYEMTKELTAKFTSVRNLN-YVISGAVATLIHDAISSPTDVIKQRMQMYNS----- 140

  Fly   157 RAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWINDQG--PRKSDG 219
                   ...:.:...:.:.:..|....|:..|...|.::.:..::|....:..::.  .||.:.
  Fly   141 -------PYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNP 198

  Fly   220 SGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEKKFKGIMDCVNRTLKEEGISAFFKGG 284
            ...      :.||..:|..:|.:.||.||:||.|........:|:::...:.....|...||:|.
  Fly   199 PVH------MAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMAGPLGFFRGT 257

  Fly   285 LCRIMVLAPLFGIAQ------MFYFLGV 306
            ..|::...|...|..      .||..|:
  Fly   258 TARVLYSMPATAICWSTYEFFKFYLCGL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 57/263 (22%)
Mito_carr 16..106 CDD:278578 23/78 (29%)
Mito_carr 123..203 CDD:278578 11/79 (14%)
Mito_carr 228..302 CDD:278578 19/79 (24%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 23/80 (29%)
PTZ00168 17..280 CDD:185494 59/281 (21%)
Mito_carr 107..190 CDD:278578 13/95 (14%)
Mito_carr <215..282 CDD:278578 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.