DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG4743

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:332 Identity:87/332 - (26%)
Similarity:143/332 - (43%) Gaps:76/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KNQEQKKPQKFNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTI 72
            |.||.....||  |..::.|||||::....::|:|.||||||:: :|             |.:  
  Fly    17 KMQEPVNKLKF--FHALVAGGVAGMVVDIALFPIDTVKTRLQSE-LG-------------FWR-- 63

  Fly    73 ASEGYFGMYRGSAVNIVLITPEKAIKLTANDFFRYHLAS-----DDGVIPLSRATLAGGLAGLFQ 132
             :.|:.|:|:|.|.......|..|:.....:..:..|:|     |...:.::.|:.|..||.|.:
  Fly    64 -AGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIR 127

  Fly   133 IVVTTPMELLKIQMQDAGRVAAADRAAGREV--KTITALGLTKTLLRERGIFGLYKGVGATGVRD 195
            :    |:|:.|.:.|    ....::.:|.::  :.....||.:         |||:|.|:|.:|:
  Fly   128 V----PVEIAKQRSQ----TLQGNKQSGLQILLRAYRTEGLKR---------GLYRGFGSTIMRE 175

  Fly   196 ITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWS------------LIAGLLSGMTSAFMVTPFDV 248
            |.||::.|||..:...|              |:            .:.|.::|..||.:.||.||
  Fly   176 IPFSLIQFPLWEYFKLQ--------------WTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDV 226

  Fly   249 VKTRLQADGEKKFKGIMDCVNRTLK----EEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEK 309
            ||||:.. .|::.........|.|.    |.|.|..|.|.:.|::.:.  .|.|..|.|..:..:
  Fly   227 VKTRIML-AERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWIT--LGGAFFFGFYDLTTR 288

  Fly   310 ILGIERT 316
            |||...|
  Fly   289 ILGATST 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 76/297 (26%)
Mito_carr 16..106 CDD:278578 25/89 (28%)
Mito_carr 123..203 CDD:278578 21/81 (26%)
Mito_carr 228..302 CDD:278578 23/89 (26%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/94 (27%)
PTZ00168 25..281 CDD:185494 78/308 (25%)
Mito_carr 199..291 CDD:278578 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.