DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG5805

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:323 Identity:78/323 - (24%)
Similarity:121/323 - (37%) Gaps:91/323 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRG---SAVNIV----LITPE 94
            |::||.::||:||.|    :...:|..:.||..|...|||..|:|||   |:|.||    .|:..
  Fly    56 CLFPLTVIKTQLQVQ----HKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTY 116

  Fly    95 KAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAA 159
            :.::         |:.:|.|.....:|...||.|.|....:..|.:::.......|..|.|....
  Fly   117 EGVR---------HVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKG 172

  Fly   160 -----------GREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFP--LMAWIND 211
                       ||. :...::.:.:.::|..|..|.|:|..|:       .|.|.|  .|.|   
  Fly   173 DINPLGIKSWPGRS-RLHISMDIGREIMRRDGFRGFYRGYTAS-------LMAYVPNSAMWW--- 226

  Fly   212 QGPRKSDGSGEAVFY-------------W------SLIAGLLSGMTSAFMVTPFDVVKTRLQADG 257
                        .||             |      ..:||.|.|.|:..:..|.|:|:.|||.  
  Fly   227 ------------AFYHLYQDELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQV-- 277

  Fly   258 EKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPL-FGIAQMFYFLGVGEKILGIERTKSV 319
             .:...:........:||.::.||||...|::..|.. |.|            |||.|..|.:
  Fly   278 -HRLDSMSVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSI------------ILGYETIKRI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 70/290 (24%)
Mito_carr 16..106 CDD:278578 24/75 (32%)
Mito_carr 123..203 CDD:278578 17/90 (19%)
Mito_carr 228..302 CDD:278578 21/74 (28%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 25/81 (31%)
Mito_carr 132..238 CDD:395101 24/128 (19%)
Mito_carr 245..327 CDD:395101 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.