DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and DPCoAC

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:309 Identity:80/309 - (25%)
Similarity:133/309 - (43%) Gaps:46/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QKFN-VFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFG 79
            ||.: |...:|:|..||.:....:.|||..|...|.:...|..   :.:.....:.|.|:||...
  Fly    67 QKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFS---FRASLRYLQNTYANEGVLA 128

  Fly    80 MYRGSAVNIVLITPEKAIKLTANDFFRYHLASD-DGVIPLSRATLAGGLAGLFQIVVTTPMELLK 143
            ::||::..:..|.|..||:.||::.:|..|..| ||.....|..|||.|||:....:|.|::|.:
  Fly   129 LWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLAR 193

  Fly   144 IQMQDAGRVAAADRAAG-REVKTITALGLTKTLLRERGIFGLYKGVGAT--------GVRDITFS 199
                  .|:|..||..| |.::.:    .||..: |.|...|::|..||        |....|:.
  Fly   194 ------ARMAVTDRYTGYRTLRQV----FTKIWV-EEGPRTLFRGYWATVLGVIPYAGTSFFTYE 247

  Fly   200 MV---YFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ-----AD 256
            .:   |:.::            |:.:.....||..|..:|........|.|:|:.|:|     ..
  Fly   248 TLKREYYEVV------------GNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTA 300

  Fly   257 GEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPL-FGIAQMFYFL 304
            |..::..|::.:.:..:|||:...|..||....:..|: .||:...|.|
  Fly   301 GGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 75/291 (26%)
Mito_carr 16..106 CDD:278578 25/90 (28%)
Mito_carr 123..203 CDD:278578 25/91 (27%)
Mito_carr 228..302 CDD:278578 20/79 (25%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/89 (27%)
Mito_carr 169..251 CDD:278578 26/92 (28%)
Mito_carr 279..356 CDD:278578 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.