DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG2616

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:372 Identity:90/372 - (24%)
Similarity:159/372 - (42%) Gaps:95/372 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQKNQEQK--KPQKFNVFP--KIINGGVAGIIGVACVYPLDMVKTRLQNQ--------------- 51
            :.|:..:|  ...:|.:.|  ::|:.....:|....:.|||::|||:|:|               
  Fly    72 DSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLM 136

  Fly    52 ----TIGPNGERM--------YTSIADCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDF 104
                ..||||..:        ::|..|...|....||...::.|....:|...|...|...|.:.
  Fly   137 DHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQ 201

  Fly   105 F--RY---------------HLASDD------GVIPLSRATLAGGLAGLFQIVVTTPMELLKIQM 146
            |  ||               ||...|      .|:|:    ::|..|.:..:.|.:|:||::.:|
  Fly   202 FKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPM----MSGVTARICAVTVVSPIELVRTKM 262

  Fly   147 QDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWIND 211
            | |.|...|...  :.|:::.||         :|::||::|:..|.:||:.||.:|:|:.     
  Fly   263 Q-AQRQTYAQML--QFVRSVVAL---------QGVWGLWRGLRPTILRDVPFSGIYWPIY----- 310

  Fly   212 QGPRKSDGSG-EAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD-GEKKF-----------KG 263
            :..:::.|.| :..|..|.:||:::|..:|.:.||||||||..|.: ||:..           |.
  Fly   311 ESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKS 375

  Fly   264 IMDCVNRTLKEEGISAFFKGGLCRIMVLAP-------LFGIAQMFYF 303
            ....:....:..|:...|.|...|::.:||       .|..::.|:|
  Fly   376 TFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFFF 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 83/339 (24%)
Mito_carr 16..106 CDD:278578 27/120 (23%)
Mito_carr 123..203 CDD:278578 23/79 (29%)
Mito_carr 228..302 CDD:278578 24/92 (26%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 28/120 (23%)
Mito_carr 230..321 CDD:278578 28/111 (25%)
Mito_carr 321..425 CDD:278578 27/102 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.