DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG6893

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:246 Identity:61/246 - (24%)
Similarity:101/246 - (41%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAV 86
            |:..:|||||.|......|.|:::.|:    :....:|   .:|...::.|.:.|:..:|.|.:.
  Fly    16 PRWWSGGVAGAIAQCFTAPFDLIEARM----VVIKKDR---GMASNLQQAIRTHGFISLYDGLSA 73

  Fly    87 NIVLITPEKAIKLTANDFFRYHLASD--DGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDA 149
            .::     :.:..|:..|..|.:..:  |....|....|...|||....||.|||||:..:||  
  Fly    74 QLL-----RQLTYTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQ-- 131

  Fly   150 GRVAAADRAAGREVK---TITALGLTKTLLRERGIFGLYKGVGATGVRD--ITFSM--VYFPLMA 207
                 .:||..:|.:   .....||.: :.||.|...||.|...:.:|.  ||.|.  .|     
  Fly   132 -----VNRALPKETRWNYRNVFDGLYR-VTREEGFTKLYSGCFLSFMRSSLITISQNAAY----- 185

  Fly   208 WINDQGPR--------KSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVK 250
               ||..:        |.|.:         :..|:|.:|:||:..|  ::|
  Fly   186 ---DQAKQIYAEFFHMKHDNT---------LLHLISSVTAAFVCGP--IIK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 61/246 (25%)
Mito_carr 16..106 CDD:278578 18/83 (22%)
Mito_carr 123..203 CDD:278578 28/86 (33%)
Mito_carr 228..302 CDD:278578 7/23 (30%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 18/87 (21%)
Mito_carr 98..192 CDD:395101 32/109 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.