DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Mpcp2

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:308 Identity:80/308 - (25%)
Similarity:128/308 - (41%) Gaps:52/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GVAGIIGVAC------VYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAV 86
            |:.||:  :|      |.|||:||.|||..      :..|.::...|:.|:|.||..|:.:|...
  Fly    66 GIGGIL--SCGTTHTFVVPLDLVKCRLQVD------QAKYKNLVHGFKVTVAEEGARGLAKGWFP 122

  Fly    87 NIVLITPEKAIKLTANDFFRYHLASDDGV--IPLSRATL---AGGLAGLFQIVVTTPMELLKIQM 146
            .::..:.:...|....:.|:...|...|.  ..|.|.:|   |...|..|..:...|.|..|:::
  Fly   123 TLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKI 187

  Fly   147 QDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFP------- 204
            |.....|...|.|            ...:|:|.|:...|||:....:|.|.::|:.|.       
  Fly   188 QTIPGYANNFREA------------VPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVE 240

  Fly   205 -LMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRL-QADGEKKFKGIMDC 267
             |..::..: ||.....||.:.. :..||.::|:..|.:..|.|||.::| ||.|.....     
  Fly   241 LLYKYVVPK-PRADCTKGEQLIV-TFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAIS----- 298

  Fly   268 VNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEKILGIER 315
               ..|..|.|..:.|...||:::..|..: |.|.:.|| :..|||.|
  Fly   299 ---VAKSLGFSGMWNGLTPRIIMIGTLTAL-QWFIYDGV-KVALGIPR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 70/280 (25%)
Mito_carr 16..106 CDD:278578 22/83 (27%)
Mito_carr 123..203 CDD:278578 20/82 (24%)
Mito_carr 228..302 CDD:278578 20/74 (27%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 22/83 (27%)
Mito_carr <175..245 CDD:278578 18/81 (22%)
Mito_carr 260..338 CDD:278578 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.