DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and SCaMC

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:330 Identity:77/330 - (23%)
Similarity:136/330 - (41%) Gaps:52/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKKPQKFNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEG 76
            ||:.|....:..::.||:||.:...|..|||.:|..||.||     :||  .|::|....:...|
  Fly   277 QKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQT-----QRM--GISECMHIMLNEGG 334

  Fly    77 YFGMYRGSAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPLS--RATLAGGLAGLFQIVVTTPM 139
            ...|:||:.:|::.|.||.|.|..|.:..:..:..|||...:|  ....||..||.....:..||
  Fly   335 SRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPM 399

  Fly   140 ELLK--IQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY 202
            |:||  :.::..|:.|....||   ||          :.::.|:...|:|.....:..:.::.:.
  Fly   400 EVLKTRLALRRTGQYAGIADAA---VK----------IYKQEGVRSFYRGYVPNILGILPYAGID 451

  Fly   203 FPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQA------------ 255
            ..:...:..:.....|.:.:..|...|..|..|.........|..:|:|||||            
  Fly   452 LAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRK 516

  Fly   256 -----------DGEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEK 309
                       .||:...|:.   .:.:::||::..::|.....:.:.|...|:.:.|  ....:
  Fly   517 TQIPLKSSDAHSGEETMTGLF---RKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVY--EYTSR 576

  Fly   310 ILGIE 314
            .|||:
  Fly   577 ALGIK 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 69/301 (23%)
Mito_carr 16..106 CDD:278578 29/89 (33%)
Mito_carr 123..203 CDD:278578 18/81 (22%)
Mito_carr 228..302 CDD:278578 18/96 (19%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 28/91 (31%)
Mito_carr 375..463 CDD:278578 19/100 (19%)
Mito_carr 470..581 CDD:278578 22/115 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.