DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG18418

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:296 Identity:80/296 - (27%)
Similarity:136/296 - (45%) Gaps:36/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVN 87
            |.:.||.:|::....|.|||::|||:  |..|..|.|.|.:..:...|.:.:||...:|.|.:..
  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRM--QISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAG 79

  Fly    88 IVLITPEKAIKLTAN----DFFRYHLASDDGVIPLSRATLAGGL-AGLFQIVVTTPMELLKIQMQ 147
            ::......:.|:...    |::|.:.    |..|...|::..|: ||.|..:...|.|:..|:|.
  Fly    80 LLRQATYTSAKMGVYQMELDWYRKNF----GNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMM 140

  Fly   148 DAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY---FPLMAWI 209
            ...|:...||   |..|.:....:  .::::.|:..|::|...|..|.:..:||.   :.||.  
  Fly   141 SDNRLMPEDR---RNYKNVGDAFV--RIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMK-- 198

  Fly   210 NDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ----ADGEKKFKGIMDCVNR 270
            |......|:|     ....|.|.|:||:.::....|.|:.|||:|    .||:.::.|.:|.:.:
  Fly   199 NQLHGYLSEG-----IPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKK 258

  Fly   271 TLKEEGISAFFKGGLCRIMVLAP--LFGIAQMFYFL 304
            .||.||..|.:||....:|.:.|  :|.    |.||
  Fly   259 VLKNEGAFAVWKGFTPYLMRMGPHTIFS----FVFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 74/277 (27%)
Mito_carr 16..106 CDD:278578 23/86 (27%)
Mito_carr 123..203 CDD:278578 20/83 (24%)
Mito_carr 228..302 CDD:278578 25/79 (32%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 25/96 (26%)
PTZ00169 18..296 CDD:240302 79/295 (27%)
Mito_carr 109..205 CDD:278578 25/102 (25%)
Mito_carr 208..300 CDD:278578 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.