DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and PMP34

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:323 Identity:68/323 - (21%)
Similarity:126/323 - (39%) Gaps:64/323 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRG-- 83
            |...::|...|.|.::..||||.|::|||.:..|.     ..|.....::.:..||:..:|||  
  Fly    16 FVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGD-----VRSTRQVIKEIVLGEGFQSLYRGLG 75

  Fly    84 ------SAVNIVLITPEKAIKLTANDFF-RYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMEL 141
                  ...|.|......|:|..|:... ..|.|..|        .|.|.:||:..::.|||..:
  Fly    76 PVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKD--------LLLGSIAGIINVLTTTPFWV 132

  Fly   142 L--KIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKG-------VGATGVRDIT 197
            :  :::|::   ||.......:..|.:.. || |.:..:.||.||:.|       |....::.:.
  Fly   133 VNTRLRMRN---VAGTSDEVNKHYKNLLE-GL-KYVAEKEGIAGLWSGTIPSLMLVSNPALQFMM 192

  Fly   198 FSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTR---------- 252
            :.|:...:|.:...:       .|...|::   .|.::...:..:..|..:|:|:          
  Fly   193 YEMLKRNIMRFTGGE-------MGSLSFFF---IGAIAKAFATVLTYPLQLVQTKQRHRSKESDS 247

  Fly   253 ---LQADGEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEKILG 312
               ..|....:.:..::.:...|:.:||...|:|...:|:.......:..|.|     |||.|
  Fly   248 KPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAY-----EKIAG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 61/298 (20%)
Mito_carr 16..106 CDD:278578 24/93 (26%)
Mito_carr 123..203 CDD:278578 21/88 (24%)
Mito_carr 228..302 CDD:278578 12/86 (14%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 22/84 (26%)
Mito_carr 105..202 CDD:278578 24/109 (22%)
Mito_carr 214..303 CDD:278578 14/96 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.