DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Shawn

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:368 Identity:85/368 - (23%)
Similarity:147/368 - (39%) Gaps:85/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFNVFP-KIINGGVAGIIGVAC-VYPLDMVKTRLQNQ---------------------TIGPNGE 58
            :|.:.| :.:.....|.:..|| :.|||::|||||.|                     ..||:..
  Fly    34 RFRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTP 98

  Fly    59 R--------MYTSIADCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDFFRYH------- 108
            .        .::...|.|.|...:||...::.|.:..::...|...|...|.:.|:..       
  Fly    99 NPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYK 163

  Fly   109 -------LASD-DGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKT 165
                   :|.| ...||.....|||....:..:...:|:||::.:|| :.|:..|:         
  Fly   164 YTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQ-SQRMTHAE--------- 218

  Fly   166 ITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLI 230
              ..|..:.:::.:|:.||::|:..|.:||:.||.:|:....::     :.|.|..|..|.:|..
  Fly   219 --MFGTIRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYL-----KSSFGVVEPTFSFSFA 276

  Fly   231 AGLLSGMTSAFMVTPFDVVKTRLQADGEKKF------------KGIMDCVNRTLKEEGISAFFKG 283
            ||.:||..:|.:.||||||||..|.:..:||            |.:...:....:..|:.|.|.|
  Fly   277 AGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSG 341

  Fly   284 ---------GLCRIMVLAPLFGIAQMFYFLGVGEKILGIERTK 317
                     ..|.||:.:..:| ...||...:.:.....:.||
  Fly   342 LGPRLFKVAPACAIMISSFEYG-KSFFYHYNIDQHNRSNQATK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 78/338 (23%)
Mito_carr 16..106 CDD:278578 25/119 (21%)
Mito_carr 123..203 CDD:278578 20/79 (25%)
Mito_carr 228..302 CDD:278578 26/94 (28%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/119 (21%)
Mito_carr 178..265 CDD:278578 24/103 (23%)
Mito_carr 268..371 CDD:278578 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.