DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Tyler

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:406 Identity:81/406 - (19%)
Similarity:148/406 - (36%) Gaps:138/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFNVFP--KIINGGVAGIIGVACVYPLDMVKTRLQNQ-------TIG------------------ 54
            ::.:.|  ::::..|.|:|....|.||::||||:|.|       |:.                  
  Fly    40 RYRIKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSS 104

  Fly    55 ----------PNGERMYTSIADCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDFFRYHL 109
                      |...|......|.|.|.:.:.|:.|::.|.:..:|...|...|.....::.:..|
  Fly   105 DICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSL 169

  Fly   110 A-------------------SDDGVIPLSRAT---------------------LAGGLAGLFQIV 134
            :                   ..||..||.:||                     :|.|:... .||
  Fly   170 SHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSR-TIV 233

  Fly   135 VT--TPMELLKIQMQDAGRVAAADRAAGREVKTITAL-GLTKTLLRERGIFGLYKGVGATGVRDI 196
            ||  ||:|:::|:||.             |..|...| .:.::|:|:.||.||::|...|.:||.
  Fly   234 VTAITPIEMVRIKMQS-------------EYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDA 285

  Fly   197 TFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD-GE-- 258
            .||..|     |...:..:::....|..|.:|.:.|.:||..:.|:..|||::.|..|.: |:  
  Fly   286 PFSGTY-----WAVYEAIKRAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDV 345

  Fly   259 -----------------------------KKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAP- 293
                                         .....::..:.:..:.:|:...:.|.:.|::.:.| 
  Fly   346 LYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPA 410

  Fly   294 ------LFGIAQMFYF 303
                  .|..::.|:|
  Fly   411 CAIMISTFEYSKSFFF 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 77/383 (20%)
Mito_carr 16..106 CDD:278578 25/125 (20%)
Mito_carr 123..203 CDD:278578 27/82 (33%)
Mito_carr 228..302 CDD:278578 16/112 (14%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 26/129 (20%)
Mito_carr 216..302 CDD:278578 29/104 (28%)
Mito_carr 306..429 CDD:278578 20/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.