DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG8026

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:302 Identity:78/302 - (25%)
Similarity:132/302 - (43%) Gaps:37/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KNQEQKKPQKFNVFPKI-----INGGVAGIIGVACVYPLDMVKTRL-----QNQTIGPNGERMYT 62
            |.|....|:|||||..:     :.|...|::....::|||::|.|.     :..|:     ..|.
  Fly     5 KAQSTGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATV-----PQYR 64

  Fly    63 SIADCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPL--SRATLAG 125
            .::..|......||:.|:|:|...|:........:.....:..:..:...:..:||  :...||.
  Fly    65 GLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAA 129

  Fly   126 GLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVK-TITALGLTKTLLRERGIFGLYKGV- 188
            ..:|:..:::|.|:.::|.::     ....|.|:..|.: .|.|||   .:.:|.||.|||:|. 
  Fly   130 AESGILTLLLTNPIWVVKTRL-----CLQCDAASSAEYRGMIHALG---QIYKEEGIRGLYRGFV 186

  Fly   189 -GATGVRD--ITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVK 250
             |..||..  |.| |.|..|....|:......|.......|.:..|  :|.:.:|....|:.||:
  Fly   187 PGMLGVSHGAIQF-MTYEELKNAYNEYRKLPIDTKLATTEYLAFAA--VSKLIAAAATYPYQVVR 248

  Fly   251 TRLQADGEKKFKGIMDCVNRTLKEEGISAFFKG---GLCRIM 289
            .||| |...::.|..||:.:|.:.||...|:||   .|.|::
  Fly   249 ARLQ-DHHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 76/294 (26%)
Mito_carr 16..106 CDD:278578 21/99 (21%)
Mito_carr 123..203 CDD:278578 26/84 (31%)
Mito_carr 228..302 CDD:278578 21/65 (32%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 74/290 (26%)
Mito_carr 23..115 CDD:278578 16/96 (17%)
Mito_carr 119..213 CDD:278578 31/102 (30%)
Mito_carr 220..307 CDD:278578 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.