DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG4995

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:129/279 - (46%) Gaps:47/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PKIINGGVAGII----GVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYR 82
            ||::...|||::    ||...:|.|.||..|  ||..|...: |.....|||..:..:.:.|:||
  Fly    38 PKMVVDFVAGLLGGAAGVLVGHPFDTVKVHL--QTDDPRNPK-YKGTFHCFRTIVQRDKFIGLYR 99

  Fly    83 G--------SAVNIVLITPEKAIKLTANDFFRYHLASDDGVIP--LSRATLAGGLAGLFQIVVTT 137
            |        ..||.::......::..:||             |  |:....||.:||:.|..|..
  Fly   100 GISSPMGGIGLVNAIVFGVYGNVQRLSND-------------PNSLTSHFFAGSIAGVAQGFVCA 151

  Fly   138 PMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY 202
            ||||.|.::|.:.:|.:.       :|....:...|.:::..||.|.:||:.||.:|||.....|
  Fly   152 PMELAKTRLQLSTQVDSG-------IKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASY 209

  Fly   203 FPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD---GEKKFKGI 264
            |....::    .|:.:..|.|   ::|:||..:||:|.....|.|||||.:|||   ...|:.|.
  Fly   210 FVSFEYL----MRQVETPGVA---YTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGF 267

  Fly   265 MDCVNRTLKEEGISAFFKG 283
            :||..:..:.||...||:|
  Fly   268 IDCAMKGFRNEGPQYFFRG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 83/279 (30%)
Mito_carr 16..106 CDD:278578 27/95 (28%)
Mito_carr 123..203 CDD:278578 25/79 (32%)
Mito_carr 228..302 CDD:278578 24/59 (41%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/89 (28%)
PTZ00169 41..295 CDD:240302 81/276 (29%)
Mito_carr 128..218 CDD:278578 30/113 (27%)
Mito_carr 221..304 CDD:278578 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.