DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Ucp4C

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:314 Identity:74/314 - (23%)
Similarity:138/314 - (43%) Gaps:51/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NVFPKIINGGVAGIIGVACVYPLDMVKTRLQ--NQTIGPNGERMYTSIADCFRKTIAS----EGY 77
            |:|...:|..:...:..:||:|||:.|||:|  .:.....|:.|.|     ||.|:.:    ||:
  Fly    35 NLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPT-----FRATLTNMIRVEGF 94

  Fly    78 FGMYRGSAVNIVLITPEKAIKLTANDFFR----YHLASDDGVIPLSRATLAGGLAGLFQIVVTTP 138
            ..:|.|.:..:.......::::...|.||    |....::.|:.:..|......||.....:..|
  Fly    95 KSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANP 159

  Fly   139 MELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVG---------ATG-V 193
            .:::|::||..||    .|..|.:|:..:.:.....:.|..|:..::||||         .|| |
  Fly   160 FDIVKVRMQTEGR----RRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDV 220

  Fly   194 RDITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ---A 255
            .....|...|..:..:.:..|.:            .::.:.:|:|::.:.||.||:|:|:.   .
  Fly   221 GSYDISKRTFKRLLDLEEGLPLR------------FVSSMCAGLTASVLSTPADVIKSRMMNQPV 273

  Fly   256 DGEKK---FKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGV 306
            |...|   :|..:|||.:.::|||:...:||.:.....|.|.    .:.::|.|
  Fly   274 DESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPF----SVLFWLSV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 70/295 (24%)
Mito_carr 16..106 CDD:278578 23/92 (25%)
Mito_carr 123..203 CDD:278578 21/89 (24%)
Mito_carr 228..302 CDD:278578 21/79 (27%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/79 (27%)
Mito_carr 137..232 CDD:278578 23/98 (23%)
Mito_carr 237..329 CDD:278578 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.