DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and colt

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:303 Identity:86/303 - (28%)
Similarity:141/303 - (46%) Gaps:30/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QKFNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGER-MYTSIADCFRKTIASEGYFG 79
            :|.|.....:.||..||..|...:|||.:|.|||.......||: :|....||..|||.:||..|
  Fly    11 RKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRG 75

  Fly    80 MYRGSAVNIVLITPEKAIKLTANDFFRYHLA------SDDGVIPLSRATLAGGLAGLFQIVVTTP 138
            :|:|.:..:..:.|     :.|..|..|.|.      .:|..:...:..:||..:|||..::..|
  Fly    76 LYKGMSAPLTGVAP-----IFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAP 135

  Fly   139 MELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYF 203
            .|.:|:.:|       ..:..|.|.|....:.....|.:|.|:..::||..||.:||:..:.:||
  Fly   136 GERIKVLLQ-------TQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYF 193

  Fly   204 PLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEKKFK-GIMDC 267
            .:...:.|....||: :|:.....::.||.::||....:..|.||:|:|||:..|..:| ||...
  Fly   194 LVYEALQDVAKSKSE-TGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSV 257

  Fly   268 VNRTLKEEGISAFFKGGLCRIMV------LAPLFGI--AQMFY 302
            ....:.::|..|.:: |:..||:      .|..|||  |..|:
  Fly   258 FKDLIVKDGPLALYR-GVTPIMLRAFPANAACFFGIELANKFF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 78/280 (28%)
Mito_carr 16..106 CDD:278578 30/90 (33%)
Mito_carr 123..203 CDD:278578 21/79 (27%)
Mito_carr 228..302 CDD:278578 25/82 (30%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/99 (32%)
Mito_carr 112..202 CDD:395101 23/96 (24%)
Mito_carr 210..299 CDD:395101 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.