DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Rim2

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:355 Identity:80/355 - (22%)
Similarity:138/355 - (38%) Gaps:98/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IINGGVAGIIGVACVYPLDMVKTRLQNQTI-------------GP-NG-----------ERMYT- 62
            :|.||.||.:|.....||::||||||:.|.             || ||           .::.| 
  Fly    12 LIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTT 76

  Fly    63 ---------------------------------SIADCFRKTIASEGYFGMYRGSAVNIVLITPE 94
                                             ||..|.|..:.:||...:::|...|:|.:.|.
  Fly    77 ILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPS 141

  Fly    95 KAI--------KLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQ--DA 149
            :||        |.|.|..  ..:..|..::.:..|..||.::.    ..|.|:..:|.:||  ..
  Fly   142 RAIYFCTYSQTKNTLNSL--GFVERDSPLVHIMSAASAGFVSS----TATNPIWFVKTRMQLDYN 200

  Fly   150 GRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGAT--GVRDITFSMVYFPLMAWI--- 209
            .:|....|..   ::.:.|.|         |:...|||:.|:  |:.:   :||:|.:..:|   
  Fly   201 SKVQMTVRQC---IERVYAQG---------GVAAFYKGITASYFGICE---TMVHFVIYEFIKSK 250

  Fly   210 --NDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEKKFKGIMDCVNRTL 272
              ..:..|.:|..|...|...::||.:|...::.:..|.:|.:|||:.:| .|:......::...
  Fly   251 LLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEG-NKYNSFWQTLHTVW 314

  Fly   273 KEEGISAFFKGGLCRIMVLAPLFGIAQMFY 302
            ||||.:..::|...:::...|...|....|
  Fly   315 KEEGRAGLYRGLATQLVRQIPNTAIMMATY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 77/340 (23%)
Mito_carr 16..106 CDD:278578 35/148 (24%)
Mito_carr 123..203 CDD:278578 19/83 (23%)
Mito_carr 228..302 CDD:278578 17/73 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 33/143 (23%)
Mito_carr 163..253 CDD:278578 23/108 (21%)
Mito_carr 268..355 CDD:278578 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.