DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG1628

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:314 Identity:84/314 - (26%)
Similarity:130/314 - (41%) Gaps:74/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 INGG--------VAGII--------GVACVY---PLDMVKTRLQNQTIGPNGERMYTSIADCFRK 70
            ::||        |.|:|        |.|.||   |||.||.:||      .....|..:.|||..
  Fly   155 MHGGGTGNNINFVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQ------TFPEAYRGMLDCFLS 213

  Fly    71 TIASEGYF-GMYRGSAVNIVLITPEKAIKLTA----NDFFRYHLASDD-GVIPLSRATLAGGLAG 129
            |...:|.. |:|.||...:.....|.::...|    ..|..:.:..:. |.:...:...||.||.
  Fly   214 TYRKDGVLRGLYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAA 278

  Fly   130 LFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKTI----------TALGLTKTLLRERGIFGL 184
            .|..:...|.||:|.::|           |.||:|..          |...||:.:.|..||.|.
  Fly   279 CFSTLTLCPTELIKCKLQ-----------ALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGF 332

  Fly   185 YKGVGATGVRDITFSMVYFPLMAWINDQGP----RKSDGSGEAVF-YWSLIAGLLSGM---TSAF 241
            |:|:.:|.:|::.....:|.     :.:|.    |:.|.|.:.:. ..::|||.:.|:   ||.|
  Fly   333 YRGLSSTFLREMPGYFFFFG-----SYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTF 392

  Fly   242 MVTPFDVVKTRLQAD--GEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAP 293
               |.||:|:|:|..  .|..|....|.|.|    ||:.|.::|.|..::...|
  Fly   393 ---PADVIKSRIQVKNLNESMFAVGADIVRR----EGVLALYRGLLPSVLRTIP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 83/308 (27%)
Mito_carr 16..106 CDD:278578 29/104 (28%)
Mito_carr 123..203 CDD:278578 25/89 (28%)
Mito_carr 228..302 CDD:278578 24/71 (34%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 82/307 (27%)
Mito_carr 170..252 CDD:278578 24/87 (28%)
Mito_carr 263..364 CDD:278578 29/116 (25%)
Mito_carr 369..455 CDD:278578 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.