DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Slc25a29

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006240603.1 Gene:Slc25a29 / 314441 RGDID:1308104 Length:310 Species:Rattus norvegicus


Alignment Length:267 Identity:77/267 - (28%)
Similarity:120/267 - (44%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GVAGIIGVACVY----PLDMVKTRLQNQTIGPNGER-MYTSIADCFRKTIASEGYFGMYRGSAVN 87
            |:|....::|:.    .|...:.|||.|    |.|: .|.....||:..|..|...|:|:|....
  Rat     9 GIASSRRLSCMLSPQPSLTETEVRLQVQ----NTEKPQYRGTLHCFQSIIKQESVLGLYKGLGSP 69

  Fly    88 IVLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLK--IQMQDAG 150
            ::.:|...|:...........|..|.   ||:: .|||..||..|.|:..||||.|  :|:|.||
  Rat    70 LMGLTFINALVFGVQGNTLRALGQDS---PLNQ-FLAGAAAGAIQCVICCPMELAKTRLQLQAAG 130

  Fly   151 RVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDI-TFSMVYFPLMAWINDQGP 214
            ...|..          .:|.....:.|..|:.|:.:|:.:|.:|:. :|.:.:..........|.
  Rat   131 PARAYK----------GSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVLTRAMGC 185

  Fly   215 RKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD---GEKKFKGIMDCVNRTLKEEG 276
            ...|   ..:....|:||..||:||.....|.||||:|||||   |..:::||:||:.::.:.||
  Rat   186 EPGD---RLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQAEG 247

  Fly   277 ISAFFKG 283
            ...|.:|
  Rat   248 WQVFTRG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 77/267 (29%)
Mito_carr 16..106 CDD:278578 20/82 (24%)
Mito_carr 123..203 CDD:278578 25/82 (30%)
Mito_carr 228..302 CDD:278578 26/59 (44%)
Slc25a29XP_006240603.1 Mito_carr <31..83 CDD:278578 16/55 (29%)
Mito_carr 92..179 CDD:278578 28/100 (28%)
Mito_carr 189..272 CDD:278578 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.