DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and CG5254

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:286 Identity:89/286 - (31%)
Similarity:141/286 - (49%) Gaps:32/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KIINGGVAGIIGVACVYPLDMVKTRLQNQ-TIGPN----GERMYTSIADCFRKTIASEGYFGMYR 82
            :::.||.||.:.|..:.|||:||||:|.| |..||    ||..|..:.|||.|....||....::
  Fly    17 QVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWK 81

  Fly    83 GSAVNIVLITPEKAIKL----TANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLK 143
            |....|:..||::|||.    .....|::   ......||: .:|||..||..:.:...|.|::|
  Fly    82 GIMPPILAETPKRAIKFLVFEQTKPLFQF---GSPTPTPLT-FSLAGLTAGTLEAIAVNPFEVVK 142

  Fly   144 IQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGI--FGLYKGVGATGVRDITFSMVYFPLM 206
            :..|           |.|:.|.::...:.|.::::.|:  .||.||:.||..|:..|:||||...
  Fly   143 VAQQ-----------ADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFY 196

  Fly   207 AWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ----ADGEKKFKGIMDC 267
            ..:.:..|...:...|  |...:..|.|:|..:.|:..||||.|:|:|    ..|:.|::|.:..
  Fly   197 HSVKNVVPEYKESHLE--FLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSS 259

  Fly   268 VNRTLKEEGISAFFKGGLCRIMVLAP 293
            :....:|||..|.:||.:.:||.|.|
  Fly   260 MGIVYREEGFRALYKGLVPKIMRLGP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 85/280 (30%)
Mito_carr 16..106 CDD:278578 33/91 (36%)
Mito_carr 123..203 CDD:278578 24/81 (30%)
Mito_carr 228..302 CDD:278578 24/70 (34%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 34/96 (35%)
PTZ00169 19..301 CDD:240302 89/284 (31%)
Mito_carr 122..207 CDD:278578 27/95 (28%)
Mito_carr 209..305 CDD:278578 26/79 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.