DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and Slc25a29

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_851845.1 Gene:Slc25a29 / 214663 MGIID:2444911 Length:306 Species:Mus musculus


Alignment Length:271 Identity:79/271 - (29%)
Similarity:123/271 - (45%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNIVLI 91
            |||||:|   ..:|.|:||.|||.|:   ..:..|.....||:..|..|...|:|:|....::.:
Mouse    11 GGVAGVI---VGHPFDIVKVRLQVQS---TEKPQYRGTLHCFQSIIKQESVLGLYKGLGSPLMGL 69

  Fly    92 TPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAAD 156
            |...|:...........|..|.   ||:: .|||..||..|.|:..||||.|.::|         
Mouse    70 TFINALVFGVQGNTLRALGQDS---PLNQ-FLAGAAAGAIQCVICCPMELAKTRLQ--------- 121

  Fly   157 RAAGREVKTITALGLTKT----------LLRERGIFGLYKGVGATGVRDI-TFSMVYFPLMAWIN 210
                     :.|:|..:|          :.|..|:.|:.:|:.:|.:|:. :|.:.:........
Mouse   122 ---------LQAVGPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTR 177

  Fly   211 DQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD---GEKKFKGIMDCVNRTL 272
            ..|....|   ..:....|:||..||:||.....|.||||:|||||   |..:::||:||:.::.
Mouse   178 AMGCEPGD---RLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSY 239

  Fly   273 KEEGISAFFKG 283
            :.||...|.:|
Mouse   240 QAEGWQVFTRG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 79/271 (29%)
Mito_carr 16..106 CDD:278578 24/78 (31%)
Mito_carr 123..203 CDD:278578 23/90 (26%)
Mito_carr 228..302 CDD:278578 26/59 (44%)
Slc25a29NP_851845.1 Mito_carr 1..79 CDD:278578 24/73 (33%)
PTZ00169 2..259 CDD:240302 79/271 (29%)
Solcar 1 2..86 24/80 (30%)
Mito_carr 88..175 CDD:278578 26/108 (24%)
Solcar 2 90..178 26/109 (24%)
Mito_carr 185..268 CDD:278578 27/69 (39%)
Solcar 3 190..275 26/61 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.