DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and slc25a22

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_002937547.2 Gene:slc25a22 / 100488953 XenbaseID:XB-GENE-22063017 Length:317 Species:Xenopus tropicalis


Alignment Length:309 Identity:162/309 - (52%)
Similarity:214/309 - (69%) Gaps:28/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVN 87
            |:||||:||:|||.||:|:|:.|||||||   .||:|||||::||..|||.||||||||||:|||
 Frog    11 KLINGGIAGLIGVTCVFPIDLAKTRLQNQ---QNGQRMYTSMSDCLIKTIRSEGYFGMYRGAAVN 72

  Fly    88 IVLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRV 152
            :.|:||||||||.||||||:.|:.|...:.|.:..|||..||..|::||||||:||||:|||||:
 Frog    73 LTLVTPEKAIKLAANDFFRHALSKDGKKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRL 137

  Fly   153 AA---------------ADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY 202
            ||               |:....|.    ||:.:::.|||..||.|||||:|||.:||:.||::|
 Frog   138 AAQRKLLASQAGPNSAVAESITARP----TAMQISRELLRSDGIAGLYKGLGATLLRDVPFSIIY 198

  Fly   203 FPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQA----DGEKKFKG 263
            |||.|.:|..|.:..|  |::.||.|.::|..:|.|:|..|.|.||:|||||:    ..|..:.|
 Frog   199 FPLFANLNKLGQKTPD--GKSPFYVSFLSGCAAGCTAAVAVNPCDVIKTRLQSLQRGINEDTYSG 261

  Fly   264 IMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEKILG 312
            |:||..:..:.||.:||.||..||.:|:||||||||:.||:|:||.:||
 Frog   262 IIDCTRKIWRSEGPAAFLKGAYCRALVIAPLFGIAQVIYFIGIGEFLLG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 146/284 (51%)
Mito_carr 16..106 CDD:278578 59/82 (72%)
Mito_carr 123..203 CDD:278578 44/94 (47%)
Mito_carr 228..302 CDD:278578 36/77 (47%)
slc25a22XP_002937547.2 Mito_carr 6..96 CDD:365909 62/87 (71%)
Mito_carr 101..208 CDD:365909 51/110 (46%)
Mito_carr 218..300 CDD:365909 38/81 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D458796at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.