DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC2 and slc25a29

DIOPT Version :9

Sequence 1:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001096191.1 Gene:slc25a29 / 100124740 XenbaseID:XB-GENE-5763797 Length:301 Species:Xenopus tropicalis


Alignment Length:299 Identity:91/299 - (30%)
Similarity:133/299 - (44%) Gaps:43/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GGVAGI-IGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNIVL 90
            ||.||: :|    :|.|.||.|||.|::   ....|.....||:..|..|...|:|:|....::.
 Frog    11 GGAAGVLVG----HPFDTVKVRLQVQSV---SNPKYRGTIHCFQSIIKQESTLGLYKGIGSPMMG 68

  Fly    91 ITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAA 155
            :|...|:..........:|..|   .||:: .|||..||..|.|:..||||.|.:||..|.....
 Frog    69 LTFINALVFGVQGNTLRYLGKD---TPLNQ-FLAGAAAGSIQCVICCPMELAKTRMQLQGTGEYK 129

  Fly   156 DRAAGREVKTI-TALGLTKTLLRERGIFGLYKGVGATGVRD--------ITFSMVYFPLMAWIND 211
            .|:     ||. .:|.....:.|:.|:.|:.:|:..|.:|:        :|:..:...|...|||
 Frog   130 SRS-----KTYKNSLDCMVKIYRKEGVRGINRGMVTTFLRETPSFGFYFLTYDYLTRYLGCEIND 189

  Fly   212 QGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD---GEKKFKGIMDCVNRTLK 273
                      ..:....|.||.:||:.|.....|.||:|:|||||   |...:.||||||.::.|
 Frog   190 ----------TFIIPKLLFAGGMSGIVSWLSTYPIDVIKSRLQADGIGGVNNYNGIMDCVRKSYK 244

  Fly   274 EEGISAFFKGGLCRIM----VLAPLFGIAQMFYFLGVGE 308
            |||...|.:|....::    |.|..|....:|.....||
 Frog   245 EEGWRVFSRGLTSTLLRAFPVNAATFATVTLFLMYMRGE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 85/274 (31%)
Mito_carr 16..106 CDD:278578 23/79 (29%)
Mito_carr 123..203 CDD:278578 26/88 (30%)
Mito_carr 228..302 CDD:278578 31/80 (39%)
slc25a29NP_001096191.1 Mito_carr 16..89 CDD:365909 20/79 (25%)
Mito_carr 91..184 CDD:365909 28/98 (29%)
Mito_carr 193..272 CDD:365909 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.