DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and SLC25A12

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_003696.2 Gene:SLC25A12 / 8604 HGNCID:10982 Length:678 Species:Homo sapiens


Alignment Length:284 Identity:123/284 - (43%)
Similarity:173/284 - (60%) Gaps:18/284 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQQIGPN--GERMYNSMFDCFRKTYKAEGYFGMYRGSGVNIL 90
            |.:||.:|.|.|:|:||||||:|||:...:  ||.||.:.||||:|..:.||:||:|||....::
Human   333 GSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLI 397

  Fly    91 LITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAA 155
            .:.||||||||.||:.|.|.|.:||.:||.::::|||.||..|:|.|.|:|::||::|.||.:..
Human   398 GVAPEKAIKLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITT 462

  Fly   156 AAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDG 220
            ..:::            |..:::|.||||||||..|..|||:.||.||||::|....|   ..|.
Human   463 GPRVS------------ALNVLRDLGIFGLYKGAKACFLRDIPFSAIYFPVYAHCKLL---LADE 512

  Fly   221 SGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCITKTLKHEGPTAF 285
            :|.........||..||..||..|.|.||:|||||...:| |:..:.|:.||..|.|:.|||:||
Human   513 NGHVGGLNLLAAGAMAGVPAASLVTPADVIKTRLQVAARA-GQTTYSGVIDCFRKILREEGPSAF 576

  Fly   286 FKGGLCRMIVIAPLFGIAQTVYYL 309
            :||...|:...:|.||:....|.|
Human   577 WKGTAARVFRSSPQFGVTLVTYEL 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 41/78 (53%)
Mito_carr 115..213 CDD:278578 39/97 (40%)
Mito_carr 226..307 CDD:278578 33/80 (41%)
SLC25A12NP_003696.2 N-terminal domain. /evidence=ECO:0000303|PubMed:25410934 2..294
EF-hand_7 16..80 CDD:290234
Linker loop domain. /evidence=ECO:0000303|PubMed:25410934 295..310
Carrier domain. /evidence=ECO:0000303|PubMed:25410934 320..612 123/284 (43%)
Mito_carr 327..420 CDD:278578 45/86 (52%)
PTZ00169 330..603 CDD:240302 123/284 (43%)
Mito_carr 422..513 CDD:278578 41/105 (39%)
Mito_carr 514..609 CDD:278578 36/88 (41%)
C-terminal domain. /evidence=ECO:0000303|PubMed:25410934 613..675
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4126
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.