DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and AGC1

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_015346.1 Gene:AGC1 / 856132 SGDID:S000006225 Length:902 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:115/286 - (40%)
Similarity:159/286 - (55%) Gaps:17/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLI 92
            |.|||.||.|.|:|:|.:|||:|.|:    ....|.:..||..|....||..|:|.|.|..::.:
Yeast   537 GSIAGCIGATVVYPIDFIKTRMQAQR----SLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGV 597

  Fly    93 TPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAA 157
            .||||||||.||:.|::||.|:|||.|..::::|..|||.|:|.|.|:|::||::|      ..:
Yeast   598 APEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQ------VQS 656

  Fly   158 KLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLN----DLGPRRN 218
            ...|:.:::  |.:.|:|::|..|:.|||.|:.|..:|||.||.||||.:|.|.    |..|...
Yeast   657 DYVGENIQQ--ANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDK 719

  Fly   219 DGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCITKTLKHEGPT 283
            ........|....||..||..||....||||:||||| |....||.::.||...|...||.|...
Yeast   720 TKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQ-IDPRKGETKYNGIFHAIRTILKEESFR 783

  Fly   284 AFFKGGLCRMIVIAPLFGIAQTVYYL 309
            :|||||..|::..:|.||.....|.|
Yeast   784 SFFKGGGARVLRSSPQFGFTLAAYEL 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 32/76 (42%)
Mito_carr 115..213 CDD:278578 38/101 (38%)
Mito_carr 226..307 CDD:278578 34/80 (43%)
AGC1NP_015346.1 Mito_carr 531..619 CDD:395101 38/85 (45%)
Mito_carr 620..713 CDD:395101 38/100 (38%)
Mito_carr 723..814 CDD:395101 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4126
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.900

Return to query results.
Submit another query.