DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and mSFC1

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_195754.1 Gene:mSFC1 / 831479 AraportID:AT5G01340 Length:309 Species:Arabidopsis thaliana


Alignment Length:291 Identity:74/291 - (25%)
Similarity:143/291 - (49%) Gaps:19/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVN 88
            |.::|.:.|::...|:.|:|::|||||..::|     .|..:..|..|..:.||...:::|....
plant    16 KAVSGSLGGVVEACCLQPIDVIKTRLQLDRVG-----AYKGIAHCGSKVVRTEGVRALWKGLTPF 75

  Fly    89 ILLITPEKAIKLTANDYFRHKL-TTKDGKLPLTSQMVAGGLAGAFQ-IIVTTPMELLKIQMQDAG 151
            ...:|.:..:::.:|..|:... .::.||:....:.::|..||..: :.:.||.|::||::|.  
plant    76 ATHLTLKYTLRMGSNAMFQTAFKDSETGKVSNRGRFLSGFGAGVLEALAIVTPFEVVKIRLQQ-- 138

  Fly   152 RVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPR 216
                ...|:.:..:.......|..:::::.|.||:.|...|.:|:.|...:.|......:.|...
plant   139 ----QKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPTVMRNGTNQAVMFTAKNAFDILLWN 199

  Fly   217 RNDGSGEAVF-WCSFLAGLAAGSTAALAVNPFDVVKTRLQA-IKKADGEKEFKGISDCITKTLKH 279
            :::|.|:.:. |.|.::|..||:.......|||||||||.| .:.::|...:||:...|......
plant   200 KHEGDGKILQPWQSMISGFLAGTAGPFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAE 264

  Fly   280 EGPTAFFKGGLCRMIVIAP----LFGIAQTV 306
            ||..|.::|.|.|::.|.|    ::.:|..|
plant   265 EGLVALWRGLLPRLMRIPPGQAIMWAVADQV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 18/77 (23%)
Mito_carr 115..213 CDD:278578 21/98 (21%)
Mito_carr 226..307 CDD:278578 29/87 (33%)
mSFC1NP_195754.1 Mito_carr 9..>74 CDD:278578 18/62 (29%)
Mito_carr 103..200 CDD:278578 22/102 (22%)
Mito_carr 210..295 CDD:278578 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53612
OrthoDB 1 1.010 - - D945010at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.