DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG7943

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:202 Identity:44/202 - (21%)
Similarity:80/202 - (39%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EGYFGMYRGSGVNILLITP--EKAIKLT------------------ANDYFRHKLTTKDGKLPLT 120
            ||...:|||      ::.|  :|.|.|:                  .|||              .
  Fly    98 EGLGFLYRG------MLPPLAQKTISLSIMFGVFDGTRRYLVEDY
RLNDY--------------G 142

  Fly   121 SQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQ-LIKDKGIFG 184
            ::::|..:||:.:.|: .|.|.::..:.|:           |..:..|.||.|.: ::...|...
  Fly   143 AKVLAAVVAGSAESIL-LPFERVQTLLADS-----------KFHQHFSNTQNAFRYVVSHHGYRE 195

  Fly   185 LYKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDV 249
            ||:|:.....|:...:.::|.|....:...|:|...|...|  ..|:||...|::.:....|.:|
  Fly   196 LYRGLEPVFWRNGLSNALFFVLREEASVRLPKRK
SVSTRTV--QEFIAGAVIGASISTIFYPLNV 258

  Fly   250 VKTRLQA 256
            :|..||:
  Fly   259 IKVSLQS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 12/56 (21%)
Mito_carr 115..213 CDD:278578 19/98 (19%)
Mito_carr 226..307 CDD:278578 9/31 (29%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 9/43 (21%)
Mito_carr 141..229 CDD:278578 21/113 (19%)
Mito_carr 235..322 CDD:278578 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.