DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and mfrn

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:287 Identity:69/287 - (24%)
Similarity:112/287 - (39%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMF----DCFRKTYKAEGYFGMYRGS 85
            :|:|.:|.:|......|.|::|.|:|          ||||.:    .|.|..||.||:...||..
  Fly   111 VISGAVATLIHDAISSPTDVIKQRMQ----------MYNSPYTSVVSCVRDIYKREGFKAFYRAY 165

  Fly    86 GVNILLITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLK--IQMQ 148
            |..:::..|.:.|..|..::|::|:.. :.|......|.||..|||....||||::::|  :..|
  Fly   166 GTQLVMNLPYQTIHFTTYEFFQNKMNL-ERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQ 229

  Fly   149 DAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDL 213
            :.|......:.:.|.....             |..|.::|         |.:.:.:.:.||    
  Fly   230 ETGLTRGMIEASRKIYHMA-------------GPLGFFRG---------TTARVLYSMPAT---- 268

  Fly   214 GPRRNDGSGEAVFWCS------FLAGLAAGS-----TAALAVNPFDVVKTRLQAIKKADGEKEFK 267
                      |:.|.:      :|.||.|..     |.:......|.|..|....::.|.|:|..
  Fly   269 ----------AICWSTYEFFKFYLCGLDADQYKSSITGSSEPRKADYVLPRTTDEEQIDQEREAA 323

  Fly   268 GISDCITKTLKHEGPTAFFKGGLCRMI 294
            ...| .|.|| |..||:....|..:.:
  Fly   324 KEKD-TTATL-HSAPTSVNASGAIKTV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 23/80 (29%)
Mito_carr 115..213 CDD:278578 21/99 (21%)
Mito_carr 226..307 CDD:278578 20/80 (25%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578
PTZ00168 17..280 CDD:185494 50/215 (23%)
Mito_carr 107..190 CDD:278578 26/88 (30%)
Mito_carr <215..282 CDD:278578 16/102 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.