DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG4743

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:278 Identity:74/278 - (26%)
Similarity:126/278 - (45%) Gaps:70/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMF 66
            |::.::|..:.:|.: :......::.||:||::....:||:|.||||||: ::|           
  Fly     9 SAAGSVAIKMQEPVN-KLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQS-ELG----------- 60

  Fly    67 DCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKL-TANDYFRHKLTTKDGKLPLTS--------- 121
                 .::|.|:.|:|:|       :.|..|... ||..:|   .|.:.||..|:|         
  Fly    61 -----FWRAGGFRGIYKG-------LAPAAAGSAPTAALFF---CTYECGKQFLSSVTQTKDSPY 110

  Fly   122 -QMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGI-FG 184
             .|.|...|.....::..|:|:.|.:.|         .|.|   .|.|..|:..:..:.:|: .|
  Fly   111 VHMAAASAAEVLACLIRVPVEIAKQRSQ---------TLQG---NKQSGLQILLRAYRTEGLKRG 163

  Fly   185 LYKGIGATGLRDVTFSIIYFPL-------FATLNDLGPRRNDGSGEAVFWCSFLA-GLAAGSTAA 241
            ||:|.|:|.:|::.||:|.|||       :..|...     |.:..:|..|..:| |::||.|  
  Fly   164 LYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGF-----DSTPFSVALCGAVAGGISAGLT-- 221

  Fly   242 LAVNPFDVVKTRLQAIKK 259
               .|.||||||:...::
  Fly   222 ---TPLDVVKTRIMLAER 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 21/77 (27%)
Mito_carr 115..213 CDD:278578 31/115 (27%)
Mito_carr 226..307 CDD:278578 13/35 (37%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 27/103 (26%)
PTZ00168 25..281 CDD:185494 71/261 (27%)
Mito_carr 199..291 CDD:278578 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.