DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG5805

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:311 Identity:74/311 - (23%)
Similarity:123/311 - (39%) Gaps:73/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRG---SGVNIL----LITPE 95
            |:|||.::||:||.|    :...:|..|.||..|.|::||..|:|||   |.|.|:    .|:..
  Fly    56 CLFPLTVIKTQLQVQ----HKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTY 116

  Fly    96 KAIKLTANDY-FRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKL 159
            :.::...||. ..|::          ..:..||.|......:..|.:::.......|..|.|...
  Fly   117 EGVRHVLND
LGAGHRM----------KALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSK 171

  Fly   160 A-----------GKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLND- 212
            .           |::...:| ..:..::::..|..|.|:|..|:.:..|..|.:::..:....| 
  Fly   172 GDINPLGIKSWPGRSRLHIS-MDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDE 235

  Fly   213 ---LGPRRNDGSGEAVFWCSFL-----AGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGI 269
               :.|          .|.|.|     ||...|.|..:..||.|:|:.||| :.:.|      .:
  Fly   236 LFR
ICP----------VWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQ-VHRLD------SM 283

  Fly   270 SDCITKTLKHEGPTAFFKGGLCRMIVIAPL-FGIAQTVYYLGVAEGLLGYQ 319
            |....:..:.|....||||...|::..|.. |.|            :|||:
  Fly   284 SVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSI------------ILGYE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 28/82 (34%)
Mito_carr 115..213 CDD:278578 17/112 (15%)
Mito_carr 226..307 CDD:278578 25/86 (29%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 25/72 (35%)
Mito_carr 132..238 CDD:395101 17/116 (15%)
Mito_carr 245..327 CDD:395101 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.