DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and DPCoAC

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:313 Identity:83/313 - (26%)
Similarity:139/313 - (44%) Gaps:30/313 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCF 69
            ||..||:.|...|   ::..:|:|..||.:..|.:.|||..|.   |.||..:....:.:.....
  Fly    59 ATTVTPMRQKIDQ---VVISLISGAAAGALAKTVIAPLDRTKI---NFQIRNDVPFSFRASLRYL 117

  Fly    70 RKTYKAEGYFGMYRGSGVNILLITPEKAIKLTANDYFRHKL-TTKDGKLPLTSQMVAGGLAGAFQ 133
            :.||..||...::||:...:..|.|..||:.||::.:|..| ..|||......:.:||.|||...
  Fly   118 QNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITS 182

  Fly   134 IIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVT 198
            ..:|.|::|.:.:|....|......|          .|:.:::..::|...|::|..||.|..:.
  Fly   183 QSLTYPLDLARARMAVTDRYTGYRTL----------RQVFTKIWVEEGPRTLFRGYWATVLGVIP 237

  Fly   199 FSIIYFPLFATLNDLGPRRN----DGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQA--I 257
            ::...|..:.||     :|.    .|:.:.....|...|.|||:....|..|.|:|:.|:|.  :
  Fly   238 YAGTSFFTYETL-----KREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRV 297

  Fly   258 KKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPL-FGIAQTVYYL 309
            ..|.|:: :..|.:.:.|..:.||....|..||....:..|: .||:.:.|.|
  Fly   298 NTAGGDR-YPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 22/77 (29%)
Mito_carr 115..213 CDD:278578 22/97 (23%)
Mito_carr 226..307 CDD:278578 23/83 (28%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 25/89 (28%)
Mito_carr 169..251 CDD:278578 21/96 (22%)
Mito_carr 279..356 CDD:278578 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.