DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and GC2

DIOPT Version :10

Sequence 1:NP_650134.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:61 Identity:17/61 - (27%)
Similarity:26/61 - (42%) Gaps:17/61 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1944 YKATYTPLTGGTYELHILWNGKHVKGSPFAVSADTSAHLADLIDVDASTLKIGIINENIKT 2004
            |:...|.|:.|.:||  |.|.:         ...:..||.|||...::.|      ||:|:
  Fly   110 YRPNDTALSIGDHEL--LLNDR---------LQSSHTHLDDLISQGSAVL------ENLKS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_650134.1 PTZ00169 37..294 CDD:240302
GC2NP_731657.2 Mito_carr 16..106 CDD:395101
Mito_carr 123..203 CDD:395101 13/48 (27%)
Mito_carr 228..302 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.