DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG16736

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:199 Identity:45/199 - (22%)
Similarity:74/199 - (37%) Gaps:59/199 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 IVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTF 199
            :::.||||:::.||  ..|...::|:...:.::.|..         |:.|.|.||.|..||....
  Fly    15 LLSHPMELVRVNMQ--ANVIHHSRLSINHMFRLMARH---------GLPGFYYGIVAACLRCTVH 68

  Fly   200 SIIYFPLFATLND------LGPRRND-GSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAI 257
            ::..:.||..|.|      |.|.... ..|...||...||            .||    .:|..|
  Fly    69 TMSTYTLFYNLQD
NKYVLMLQPYNTSMVLGITGFWGGVLA------------TPF----AKLAVI 117

  Fly   258 KKAD---GEKE-------FKGISDCITKTLKHEGPTAFFKGGLCRMIV---IAPLFGIAQTVYYL 309
            ::||   |..|       ::|:. |:           :.|||...:..   |..:...|..|.|.
  Fly   118 RQADLTRGSYERRNYRNFWRGLK-CM-----------YAKGGFTYLFTGWKINSISSTAVAVLYT 170

  Fly   310 GVAE 313
            .:::
  Fly   171 PISD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578
Mito_carr 115..213 CDD:278578 21/83 (25%)
Mito_carr 226..307 CDD:278578 19/93 (20%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 20/76 (26%)
Mito_carr 187..277 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.